PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G436200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 362aa    MW: 38721.6 Da    PI: 4.903
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G436200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rgrWT+eEde+l+++++++G g+W++ ++  g+ R++k+c++rw +yl
  Sevir.9G436200.1.p 14 RGRWTAEEDEILANYIAKHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                        8*******************************99************97 PP

2Myb_DNA-binding52.31.4e-1667112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+ ++eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  Sevir.9G436200.1.p  67 RGNISKEEEDVIIKLHATLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                         7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.458961IPR017930Myb domain
SuperFamilySSF466892.49E-2911108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001672.53E-111661No hitNo description
PROSITE profilePS5129425.42262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2565116IPR009057Homeodomain-like
SMARTSM007179.5E-1766114IPR001005SANT/Myb domain
PfamPF002495.7E-1567112IPR001005SANT/Myb domain
CDDcd001673.56E-1271112No hitNo description
PfamPF066405.7E-106130361IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDEILANYIA KHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADVKRGNI SKEEEDVIIK LHATLGNRWS LIASHLPGRT DNEIKNYWNS HLSRQIHTYR  120
RTYTAGPDTT ITIDISKLHS AEKRRGGRTP GRSPKRATTS SGGGSNKAKS KELPDPDSKK  180
PEPESGEAKV ASGPVAAAAS AASSPRHSDG ARSAVVDPDQ NQPDSSSGAG GGSTPEGPCS  240
EDTTGPLAAL DPMEFGGLWE AESEMELLLS SGGVEAGPDP LTGFVDAVGE AGQVDDLLDM  300
DWDGFAAHIW GDHPTAQVQQ QNDDDQSTLL QPDGPQAAAG CNEHQEDELE SFATWLLSDS  360
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24121185110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283951e-168KJ728395.1 Zea mays clone pUT6679 MYB transcription factor (MYB3) mRNA, partial cds.
GenBankZMU570021e-168U57002.1 Zea mays P protein (P) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984641.10.0PREDICTED: myb-related protein P-like
SwissprotP278981e-111MYBP_MAIZE; Myb-related protein P
TrEMBLK4AKW00.0K4AKW0_SETIT; Uncharacterized protein
STRINGSi039538m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.17e-74myb domain protein 12